Lineage for d1kmda_ (1kmd A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611551Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 2611552Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 2611553Family d.189.1.1: PX domain [64269] (6 proteins)
    Pfam PF00787
  6. 2611574Protein Vam7p [75424] (1 species)
  7. 2611575Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75425] (1 PDB entry)
  8. 2611576Domain d1kmda_: 1kmd A: [72744]

Details for d1kmda_

PDB Entry: 1kmd (more details)

PDB Description: solution structure of the vam7p px domain
PDB Compounds: (A:) Vacuolar morphogenesis protein VAM7

SCOPe Domain Sequences for d1kmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kmseklrikvddvkinpkyvlygvstpnkrlykrysefwklktrlerdvgstipydfpek
pgvldrrwqrryddpemiderriglerflnelyndrfdsrwrdtkiaqdflqlskpn

SCOPe Domain Coordinates for d1kmda_:

Click to download the PDB-style file with coordinates for d1kmda_.
(The format of our PDB-style files is described here.)

Timeline for d1kmda_: