Lineage for d1kmda_ (1kmd A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199596Fold d.189: PX domain [64267] (1 superfamily)
  4. 199597Superfamily d.189.1: PX domain [64268] (1 family) (S)
  5. 199598Family d.189.1.1: PX domain [64269] (3 proteins)
  6. 199605Protein Vam7p [75424] (1 species)
  7. 199606Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75425] (1 PDB entry)
  8. 199607Domain d1kmda_: 1kmd A: [72744]

Details for d1kmda_

PDB Entry: 1kmd (more details)

PDB Description: solution structure of the vam7p px domain

SCOP Domain Sequences for d1kmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae)}
kmseklrikvddvkinpkyvlygvstpnkrlykrysefwklktrlerdvgstipydfpek
pgvldrrwqrryddpemiderriglerflnelyndrfdsrwrdtkiaqdflqlskpn

SCOP Domain Coordinates for d1kmda_:

Click to download the PDB-style file with coordinates for d1kmda_.
(The format of our PDB-style files is described here.)

Timeline for d1kmda_: