![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries) |
![]() | Domain d1km6a_: 1km6 A: [72742] complexed with omp; mutant |
PDB Entry: 1km6 (more details), 1.5 Å
SCOPe Domain Sequences for d1km6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1km6a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]} rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiaafav adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl rfadaiivgrsiyladnpaaaaagiiesi
Timeline for d1km6a_: