Lineage for d1km5a_ (1km5 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1143783Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1143823Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 1143860Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries)
  8. 1143865Domain d1km5a_: 1km5 A: [72741]
    complexed with cl, up6; mutant

Details for d1km5a_

PDB Entry: 1km5 (more details), 1.5 Å

PDB Description: crystal structure of odcase mutant d75n complexed with 6-azaump
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1km5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1km5a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvanipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi

SCOPe Domain Coordinates for d1km5a_:

Click to download the PDB-style file with coordinates for d1km5a_.
(The format of our PDB-style files is described here.)

Timeline for d1km5a_: