Lineage for d1km5a_ (1km5 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473421Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 473466Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 473489Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 473490Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 473499Domain d1km5a_: 1km5 A: [72741]

Details for d1km5a_

PDB Entry: 1km5 (more details), 1.5 Å

PDB Description: crystal structure of odcase mutant d75n complexed with 6-azaump

SCOP Domain Sequences for d1km5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1km5a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvanipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi

SCOP Domain Coordinates for d1km5a_:

Click to download the PDB-style file with coordinates for d1km5a_.
(The format of our PDB-style files is described here.)

Timeline for d1km5a_: