Lineage for d1km3a_ (1km3 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.3: Decarboxylase [51375] (2 proteins) Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species) Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries) 
Domain d1km3a_: 1km3 A: [72739]
Details for d1km3a_
PDB Entry: 1km3 (more details), 1.5 Å
PDB Description: crystal structure of odcase mutant k42a complexed with 6-azaump
SCOP Domain Sequences for d1km3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1km3a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvaigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi
SCOP Domain Coordinates for d1km3a_:
Click to download the PDB-style file with coordinates for d1km3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1km3a_:
- d1km3a_ is new in SCOP 1.61
- d1km3a_ appears in SCOP 1.63
- d1km3a_ appears in the current release, SCOPe 2.08
View in 3D