Lineage for d1km1b_ (1km1 B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235793Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 235824Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 235831Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 235832Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 235846Domain d1km1b_: 1km1 B: [72737]
    complexed with up6; mutant

Details for d1km1b_

PDB Entry: 1km1 (more details), 1.6 Å

PDB Description: orotidine monophosphate decarboxylase mutant s127a crystal structure

SCOP Domain Sequences for d1km1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1km1b_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemahpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiies

SCOP Domain Coordinates for d1km1b_:

Click to download the PDB-style file with coordinates for d1km1b_.
(The format of our PDB-style files is described here.)

Timeline for d1km1b_: