Lineage for d1km1b_ (1km1 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172806Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 172830Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 172837Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 172838Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 172852Domain d1km1b_: 1km1 B: [72737]

Details for d1km1b_

PDB Entry: 1km1 (more details), 1.6 Å

PDB Description: orotidine monophosphate decarboxylase mutant s127a crystal structure

SCOP Domain Sequences for d1km1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1km1b_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemahpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiies

SCOP Domain Coordinates for d1km1b_:

Click to download the PDB-style file with coordinates for d1km1b_.
(The format of our PDB-style files is described here.)

Timeline for d1km1b_: