Lineage for d1km0d_ (1km0 D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172806Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 172830Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 172837Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 172838Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 172857Domain d1km0d_: 1km0 D: [72735]

Details for d1km0d_

PDB Entry: 1km0 (more details), 1.7 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase mutant d70n complexed with 6-azaump

SCOP Domain Sequences for d1km0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1km0d_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
anfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesi

SCOP Domain Coordinates for d1km0d_:

Click to download the PDB-style file with coordinates for d1km0d_.
(The format of our PDB-style files is described here.)

Timeline for d1km0d_: