SCOP 1.67: Domain d1klud1: 1klu D:1-121

Lineage for d1klud1 (1klu D:1-121)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (7 PDB entries)

8. Domain d1klud1: 1klu D:1-121 [72728]
   Other proteins in same PDB: d1klua1, d1klua2, d1klub1, d1klub2, d1klud2

Details for d1klud1

PDB Entry: 1klu, 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klud1:

Sequence, based on SEQRES records:

>d1klud1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records):

>d1klud1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsggktcmyggitkhegn

Timeline for d1klud1:

• d1klud1 first appeared in SCOP 1.61
  
• d1klud1 appears in SCOP 1.65
  
• d1klud1 appears in SCOP 1.69
  
• d1klud1 appears in the current release, SCOPe 2.08