Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries) Uniprot P01903 28-207 |
Domain d1klua2: 1klu A:4-81 [72725] Other proteins in same PDB: d1klua1, d1klub1, d1klub2, d1klud1, d1klud2 |
PDB Entry: 1klu (more details), 1.93 Å
SCOPe Domain Sequences for d1klua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klua2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1klua2:
View in 3D Domains from other chains: (mouse over for more information) d1klub1, d1klub2, d1klud1, d1klud2 |