Lineage for d1klua2 (1klu A:4-81)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255412Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries)
  8. 255413Domain d1klua2: 1klu A:4-81 [72725]
    Other proteins in same PDB: d1klua1, d1klub1, d1klud1, d1klud2

Details for d1klua2

PDB Entry: 1klu (more details), 1.93 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

SCOP Domain Sequences for d1klua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klua2 d.19.1.1 (A:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOP Domain Coordinates for d1klua2:

Click to download the PDB-style file with coordinates for d1klua2.
(The format of our PDB-style files is described here.)

Timeline for d1klua2: