Lineage for d1klpa_ (1klp A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354640Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 354641Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 354642Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (5 proteins)
  6. 354647Protein Acyl carrier protein [47338] (3 species)
  7. 354657Species Mycobacterium tuberculosis [TaxId:1773] [74711] (1 PDB entry)
  8. 354658Domain d1klpa_: 1klp A: [72721]

Details for d1klpa_

PDB Entry: 1klp (more details)

PDB Description: The Solution Structure of Acyl Carrier Protein from Mycobacterium tuberculosis

SCOP Domain Sequences for d1klpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis}
mpvtqeeiiagiaeiieevtgiepseitpeksfvddldidslsmveiavqtedkygvkip
dedlaglrtvgdvvayiqkleeenpeaaqalrakiesenpdavanvqarleaesk

SCOP Domain Coordinates for d1klpa_:

Click to download the PDB-style file with coordinates for d1klpa_.
(The format of our PDB-style files is described here.)

Timeline for d1klpa_: