Lineage for d1klpa_ (1klp A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316393Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2316394Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 protein domains)
  6. 2316399Protein Acyl carrier protein [47338] (7 species)
  7. 2316436Species Mycobacterium tuberculosis [TaxId:1773] [74711] (1 PDB entry)
  8. 2316437Domain d1klpa_: 1klp A: [72721]

Details for d1klpa_

PDB Entry: 1klp (more details)

PDB Description: The Solution Structure of Acyl Carrier Protein from Mycobacterium tuberculosis
PDB Compounds: (A:) meromycolate extension acyl carrier protein

SCOPe Domain Sequences for d1klpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]}
mpvtqeeiiagiaeiieevtgiepseitpeksfvddldidslsmveiavqtedkygvkip
dedlaglrtvgdvvayiqkleeenpeaaqalrakiesenpdavanvqarleaesk

SCOPe Domain Coordinates for d1klpa_:

Click to download the PDB-style file with coordinates for d1klpa_.
(The format of our PDB-style files is described here.)

Timeline for d1klpa_: