![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein Mitomycin resistance protein D, MRD [75394] (1 species) |
![]() | Species Streptomyces lavendulae [TaxId:1914] [75395] (2 PDB entries) |
![]() | Domain d1klla_: 1kll A: [72720] complexed with mc |
PDB Entry: 1kll (more details), 1.5 Å
SCOPe Domain Sequences for d1klla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} arislfavvvedmaksmefyrkmgveipaeadsaphteavldggirlawdtvetvrsydp ewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnv vdlfaplp
Timeline for d1klla_: