Lineage for d1klla_ (1kll A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942433Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942490Protein Mitomycin resistance protein D, MRD [75394] (1 species)
  7. 2942491Species Streptomyces lavendulae [TaxId:1914] [75395] (2 PDB entries)
  8. 2942492Domain d1klla_: 1kll A: [72720]
    complexed with mc

Details for d1klla_

PDB Entry: 1kll (more details), 1.5 Å

PDB Description: molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative
PDB Compounds: (A:) mitomycin-binding protein

SCOPe Domain Sequences for d1klla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]}
arislfavvvedmaksmefyrkmgveipaeadsaphteavldggirlawdtvetvrsydp
ewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnv
vdlfaplp

SCOPe Domain Coordinates for d1klla_:

Click to download the PDB-style file with coordinates for d1klla_.
(The format of our PDB-style files is described here.)

Timeline for d1klla_: