Lineage for d1klgd1 (1klg D:1-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2050816Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 protein domains)
  6. 2050838Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2050839Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2050850Domain d1klgd1: 1klg D:1-121 [72718]
    Other proteins in same PDB: d1klga1, d1klga2, d1klgb1, d1klgb2, d1klgd2
    mutant

Details for d1klgd1

PDB Entry: 1klg (more details), 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d1klgd1:

Sequence, based on SEQRES records: (download)

>d1klgd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d1klgd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskgktcmyggitkhegn

SCOPe Domain Coordinates for d1klgd1:

Click to download the PDB-style file with coordinates for d1klgd1.
(The format of our PDB-style files is described here.)

Timeline for d1klgd1: