SCOPe 2.03: Domain d1klga2: 1klg A:4-81

Lineage for d1klga2 (1klg A:4-81)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
   Uniprot P01903 28-207

8. Domain d1klga2: 1klg A:4-81 [72715]
   Other proteins in same PDB: d1klga1, d1klgb1, d1klgb2, d1klgd1, d1klgd2
   mutant

Details for d1klga2

PDB Entry: 1klg, 2.4 Å

PDB Description: crystal structure of hla-dr1/tpi(23-37, thr28-->ile mutant) complexed with staphylococcal enterotoxin c3 variant 3b2 (sec3-3b2)

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1klga2:

Sequence; same for both SEQRES and ATOM records:

>d1klga2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d1klga2:

• d1klga2 first appeared in SCOP 1.61
  
• d1klga2 appears in SCOPe 2.02
  
• d1klga2 appears in SCOPe 2.04
  
• d1klga2 appears in the current release, SCOPe 2.08