SCOPe 2.07: Domain d1klfp2: 1klf P:159-279

Lineage for d1klfp2 (1klf P:159-279)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (25 PDB entries)

8. Domain d1klfp2: 1klf P:159-279 [72713]
   Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2
   complexed with man

Details for d1klfp2

PDB Entry: 1klf, 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

PDB Compounds: (P:) FimH PROTEIN

SCOPe Domain Sequences for d1klfp2:

Sequence; same for both SEQRES and ATOM records:

>d1klfp2 b.2.3.2 (P:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d1klfp2:

• d1klfp2 first appeared in SCOP 1.61
  
• d1klfp2 appears in SCOPe 2.06
  
• d1klfp2 appears in the current release, SCOPe 2.08