SCOPe 2.08: Domain d1klfp2: 1klf P:159-279

Lineage for d1klfp2 (1klf P:159-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species)
   protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [419301] (4 PDB entries)

8. Domain d1klfp2: 1klf P:159-279 [72713]
   Other proteins in same PDB: d1klfa1, d1klfa2, d1klfb1, d1klfc1, d1klfc2, d1klfd1, d1klfe1, d1klfe2, d1klff1, d1klfg1, d1klfg2, d1klfh1, d1klfi1, d1klfi2, d1klfj1, d1klfk1, d1klfk2, d1klfl1, d1klfm1, d1klfm2, d1klfn1, d1klfo1, d1klfo2, d1klfp1
   complexed with man
   missing some secondary structures that made up less than one-third of the common domain

Details for d1klfp2

PDB Entry: 1klf, 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

PDB Compounds: (P:) FimH PROTEIN

SCOPe Domain Sequences for d1klfp2:

Sequence; same for both SEQRES and ATOM records:

>d1klfp2 b.2.3.2 (P:159-279) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d1klfp2:

• d1klfp2 first appeared in SCOP 1.61
  
• d1klfp2 appears in SCOPe 2.07