Lineage for d1klfn1 (1klf N:1-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767497Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767498Species Escherichia coli [TaxId:562] [419300] (24 PDB entries)
  8. 2767550Domain d1klfn1: 1klf N:1-158 [72708]
    Other proteins in same PDB: d1klfa1, d1klfa2, d1klfb2, d1klfc1, d1klfc2, d1klfd2, d1klfe1, d1klfe2, d1klff2, d1klfg1, d1klfg2, d1klfh2, d1klfi1, d1klfi2, d1klfj2, d1klfk1, d1klfk2, d1klfl2, d1klfm1, d1klfm2, d1klfn2, d1klfo1, d1klfo2, d1klfp2
    complexed with man

Details for d1klfn1

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose
PDB Compounds: (N:) FimH PROTEIN

SCOPe Domain Sequences for d1klfn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfn1 b.2.3.2 (N:1-158) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d1klfn1:

Click to download the PDB-style file with coordinates for d1klfn1.
(The format of our PDB-style files is described here.)

Timeline for d1klfn1: