Lineage for d1klfm1 (1klf M:1-121)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223121Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 223122Family b.1.11.1: Pilus chaperone [49355] (3 proteins)
  6. 223123Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 223124Species Escherichia coli [TaxId:562] [49359] (4 PDB entries)
  8. 223131Domain d1klfm1: 1klf M:1-121 [72706]
    Other proteins in same PDB: d1klfa2, d1klfb1, d1klfb2, d1klfc2, d1klfd1, d1klfd2, d1klfe2, d1klff1, d1klff2, d1klfg2, d1klfh1, d1klfh2, d1klfi2, d1klfj1, d1klfj2, d1klfk2, d1klfl1, d1klfl2, d1klfm2, d1klfn1, d1klfn2, d1klfo2, d1klfp1, d1klfp2

Details for d1klfm1

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

SCOP Domain Sequences for d1klfm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfm1 b.1.11.1 (M:1-121) Periplasmic chaperone FimC {Escherichia coli}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOP Domain Coordinates for d1klfm1:

Click to download the PDB-style file with coordinates for d1klfm1.
(The format of our PDB-style files is described here.)

Timeline for d1klfm1: