SCOP 1.75: Domain d1klfl1: 1klf L:1-158

Lineage for d1klfl1 (1klf L:1-158)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (8 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (7 PDB entries)

8. Domain d1klfl1: 1klf L:1-158 [72704]
   Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2

Details for d1klfl1

PDB Entry: 1klf, 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

PDB Compounds: (L:) FimH PROTEIN

SCOP Domain Sequences for d1klfl1:

Sequence; same for both SEQRES and ATOM records:

>d1klfl1 b.2.3.2 (L:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d1klfl1:

• d1klfl1 first appeared in SCOP 1.61
  
• d1klfl1 appears in SCOP 1.73
  
• d1klfl1 appears in SCOPe 2.01
  
• d1klfl1 appears in the current release, SCOPe 2.08