Lineage for d1klfl1 (1klf L:1-158)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368306Superfamily b.2.3: Bacterial adhesins [49401] (5 families) (S)
  5. 368311Family b.2.3.2: Pilus subunits [49405] (4 proteins)
  6. 368317Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 368318Species Escherichia coli [TaxId:562] [49407] (3 PDB entries)
  8. 368329Domain d1klfl1: 1klf L:1-158 [72704]
    Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2

Details for d1klfl1

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

SCOP Domain Sequences for d1klfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfl1 b.2.3.2 (L:1-158) Mannose-specific adhesin FimH {Escherichia coli}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOP Domain Coordinates for d1klfl1:

Click to download the PDB-style file with coordinates for d1klfl1.
(The format of our PDB-style files is described here.)

Timeline for d1klfl1: