Lineage for d1klfk1 (1klf K:1-121)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111327Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 1111328Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 1111340Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 1111341Species Escherichia coli [TaxId:562] [49359] (6 PDB entries)
  8. 1111349Domain d1klfk1: 1klf K:1-121 [72702]
    Other proteins in same PDB: d1klfa2, d1klfb1, d1klfb2, d1klfc2, d1klfd1, d1klfd2, d1klfe2, d1klff1, d1klff2, d1klfg2, d1klfh1, d1klfh2, d1klfi2, d1klfj1, d1klfj2, d1klfk2, d1klfl1, d1klfl2, d1klfm2, d1klfn1, d1klfn2, d1klfo2, d1klfp1, d1klfp2
    complexed with man

Details for d1klfk1

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose
PDB Compounds: (K:) chaperone protein fimc

SCOPe Domain Sequences for d1klfk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfk1 b.1.11.1 (K:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOPe Domain Coordinates for d1klfk1:

Click to download the PDB-style file with coordinates for d1klfk1.
(The format of our PDB-style files is described here.)

Timeline for d1klfk1: