Lineage for d1klfj1 (1klf J:1-158)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525399Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1525404Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1525421Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1525422Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)
  8. 1525467Domain d1klfj1: 1klf J:1-158 [72700]
    Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2
    complexed with man

Details for d1klfj1

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose
PDB Compounds: (J:) FimH PROTEIN

SCOPe Domain Sequences for d1klfj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfj1 b.2.3.2 (J:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d1klfj1:

Click to download the PDB-style file with coordinates for d1klfj1.
(The format of our PDB-style files is described here.)

Timeline for d1klfj1: