SCOP 1.61: Domain d1klfh2: 1klf H:159-279

Lineage for d1klfh2 (1klf H:159-279)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.3: Bacterial adhesins [49401] (3 families)

5. Family b.2.3.2: Pilus subunits [49405] (2 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)

7. Species Escherichia coli [TaxId:562] [49407] (3 PDB entries)

8. Domain d1klfh2: 1klf H:159-279 [72697]
   Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2

Details for d1klfh2

PDB Entry: 1klf, 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

SCOP Domain Sequences for d1klfh2:

Sequence; same for both SEQRES and ATOM records:

>d1klfh2 b.2.3.2 (H:159-279) Mannose-specific adhesin FimH {Escherichia coli}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d1klfh2:

• d1klfh2 is new in SCOP 1.61
  
• d1klfh2 appears in SCOP 1.63
  
• d1klfh2 appears in the current release, SCOPe 2.08