Lineage for d1klfb2 (1klf B:159-279)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223643Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 223702Superfamily b.2.3: Bacterial adhesins [49401] (3 families) (S)
  5. 223707Family b.2.3.2: Pilus subunits [49405] (3 proteins)
  6. 223708Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 223709Species Escherichia coli [TaxId:562] [49407] (3 PDB entries)
  8. 223711Domain d1klfb2: 1klf B:159-279 [72685]
    Other proteins in same PDB: d1klfa1, d1klfa2, d1klfc1, d1klfc2, d1klfe1, d1klfe2, d1klfg1, d1klfg2, d1klfi1, d1klfi2, d1klfk1, d1klfk2, d1klfm1, d1klfm2, d1klfo1, d1klfo2

Details for d1klfb2

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

SCOP Domain Sequences for d1klfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfb2 b.2.3.2 (B:159-279) Mannose-specific adhesin FimH {Escherichia coli}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOP Domain Coordinates for d1klfb2:

Click to download the PDB-style file with coordinates for d1klfb2.
(The format of our PDB-style files is described here.)

Timeline for d1klfb2: