Lineage for d1klfa1 (1klf A:1-121)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161647Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 161648Family b.1.11.1: Pilus chaperone [49355] (3 proteins)
  6. 161649Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 161650Species Escherichia coli [TaxId:562] [49359] (4 PDB entries)
  8. 161651Domain d1klfa1: 1klf A:1-121 [72682]
    Other proteins in same PDB: d1klfa2, d1klfb1, d1klfb2, d1klfc2, d1klfd1, d1klfd2, d1klfe2, d1klff1, d1klff2, d1klfg2, d1klfh1, d1klfh2, d1klfi2, d1klfj1, d1klfj2, d1klfk2, d1klfl1, d1klfl2, d1klfm2, d1klfn1, d1klfn2, d1klfo2, d1klfp1, d1klfp2

Details for d1klfa1

PDB Entry: 1klf (more details), 2.79 Å

PDB Description: fimh adhesin-fimc chaperone complex with d-mannose

SCOP Domain Sequences for d1klfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klfa1 b.1.11.1 (A:1-121) Periplasmic chaperone FimC {Escherichia coli}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOP Domain Coordinates for d1klfa1:

Click to download the PDB-style file with coordinates for d1klfa1.
(The format of our PDB-style files is described here.)

Timeline for d1klfa1: