Lineage for d1kl7b_ (1kl7 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185419Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 185420Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 185421Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 185460Protein Threonine synthase [64172] (2 species)
  7. 185461Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75313] (1 PDB entry)
  8. 185463Domain d1kl7b_: 1kl7 B: [72679]

Details for d1kl7b_

PDB Entry: 1kl7 (more details), 2.7 Å

PDB Description: crystal structure of threonine synthase from yeast

SCOP Domain Sequences for d1kl7b_:

Sequence, based on SEQRES records: (download)

>d1kl7b_ c.79.1.1 (B:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae)}
pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnskhnvgavns
inwarilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaia
tnendildrflksglyersdkvaatlspamdilissnferllwylareylangddlkage
ivnnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildp
htavgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelk
klstlkkklkfieradvelvknaieeelakm

Sequence, based on observed residues (ATOM records): (download)

>d1kl7b_ c.79.1.1 (B:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae)}
pnasqvyrstrssspktisfeeaiiqglatdgglfipptipqvdqatlfndwsklsfqdl
afaimrlyiaqeeipdadlkdlikrsystfrsdevtplvqnvtgdkenlhilelfhgpty
afkdvalqfvgnlfeyflqrtnanlpegekkqitvvgatsgdtgsaaiyglrgkkdvsvf
ilyptgrispiqeeqmttvpdenvqtlsvtgtfdncqdivkaifgdkefnhnvgavnsin
warilaqmtyyfysffqatngkdskkvkfvvpsgnfgdilagyfakkmglpieklaiatn
endildrflksglyersdkvaatlspamdilissnferllwylareylangddlkageiv
nnwfqelktngkfqvdksiiegaskdftservsneetsetikkiyessvnpkhyildpht
avgvcaterliakdndksiqyislstahpakfadavnnalsgfsnysfekdvlpeelkkl
stlkkklkfieradvelvknaieeelakm

SCOP Domain Coordinates for d1kl7b_:

Click to download the PDB-style file with coordinates for d1kl7b_.
(The format of our PDB-style files is described here.)

Timeline for d1kl7b_: