Lineage for d1kl4d_ (1kl4 D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325094Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1325117Protein Streptavidin [50878] (1 species)
  7. 1325118Species Streptomyces avidinii [TaxId:1895] [50879] (122 PDB entries)
  8. 1325230Domain d1kl4d_: 1kl4 D: [72673]

Details for d1kl4d_

PDB Entry: 1kl4 (more details), 1.7 Å

PDB Description: an engineered streptavidin with improved affinity for the strep-tag ii peptide : apo-sam2
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1kl4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kl4d_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyigargnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

SCOPe Domain Coordinates for d1kl4d_:

Click to download the PDB-style file with coordinates for d1kl4d_.
(The format of our PDB-style files is described here.)

Timeline for d1kl4d_: