Lineage for d1kkua_ (1kku A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178484Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 178485Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 178571Family c.26.1.3: Adenylyltransferase [52397] (3 proteins)
  6. 178572Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (4 species)
  7. 178594Species Human (Homo sapiens) [TaxId:9606] [75163] (2 PDB entries)
  8. 178595Domain d1kkua_: 1kku A: [72661]

Details for d1kkua_

PDB Entry: 1kku (more details), 2.5 Å

PDB Description: Crystal structure of nuclear human nicotinamide mononucleotide adenylyltransferase

SCOP Domain Sequences for d1kkua_:

Sequence, based on SEQRES records: (download)

>d1kkua_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens)}
ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptlerpg
rkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivanygli
cvtragndaqkfiyesdvlwkhrsnihvvnewfandisstkirralrrgqsirylvpdlv
qeyiekhnlysse

Sequence, based on observed residues (ATOM records): (download)

>d1kkua_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens)}
ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdvpkvkllcgadlle
sfavpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewfandi
sstkirralrrgqsirylvpdlvqeyiekhnlysse

SCOP Domain Coordinates for d1kkua_:

Click to download the PDB-style file with coordinates for d1kkua_.
(The format of our PDB-style files is described here.)

Timeline for d1kkua_: