SCOPe 2.03: Domain d1kkmc_: 1kkm C:

Lineage for d1kkmc_ (1kkm C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families)

5. Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
   automatically mapped to Pfam PF07475

6. Protein HPr kinase HprK C-terminal domain [64187] (3 species)

7. Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries)

8. Domain d1kkmc_: 1kkm C: [72656]
   Other proteins in same PDB: d1kkmh_, d1kkmi_, d1kkmj_
   C-terminal domain in complex with P-Ser-HPr
   complexed with ca, po4

Details for d1kkmc_

PDB Entry: 1kkm, 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis p-ser-hpr

PDB Compounds: (C:) hprk protein

SCOPe Domain Sequences for d1kkmc_:

Sequence; same for both SEQRES and ATOM records:

>d1kkmc_ c.91.1.2 (C:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
rrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivgaa
ppilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtqli
fdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee

Timeline for d1kkmc_:

• d1kkmc_ first appeared in SCOP 1.61
  
• d1kkmc_ appears in SCOPe 2.02
  
• d1kkmc_ appears in SCOPe 2.04
  
• d1kkmc_ appears in the current release, SCOPe 2.08