Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) |
Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species) |
Species Bacillus subtilis [TaxId:1423] [55597] (7 PDB entries) |
Domain d1kkli_: 1kkl I: [72652] Other proteins in same PDB: d1kkla_, d1kklb_, d1kklc_ complexed with HprK/P kinase domain complexed with ca |
PDB Entry: 1kkl (more details), 2.8 Å
SCOPe Domain Sequences for d1kkli_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkli_ d.94.1.1 (I:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]} aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaei tisasgadendalnaleetmkserlge
Timeline for d1kkli_: