SCOP 1.73: Domain d1kklh_: 1kkl H:

Lineage for d1kklh_ (1kkl H:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Bacillus subtilis [TaxId:1423] [55597] (6 PDB entries)

8. Domain d1kklh_: 1kkl H: [72651]
   Other proteins in same PDB: d1kkla_, d1kklb_, d1kklc_

Details for d1kklh_

PDB Entry: 1kkl, 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis hpr

PDB Compounds: (H:) Phosphocarrier protein HPr

SCOP Domain Sequences for d1kklh_:

Sequence; same for both SEQRES and ATOM records:

>d1kklh_ d.94.1.1 (H:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]}
qktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgaeit
isasgadendalnaleetmkserlge

Timeline for d1kklh_:

• d1kklh_ first appeared in SCOP 1.61
  
• d1kklh_ appears in SCOP 1.71
  
• d1kklh_ appears in SCOP 1.75
  
• d1kklh_ appears in the current release, SCOPe 2.08