SCOPe 2.05: Domain d1kklb_: 1kkl B:

Lineage for d1kklb_ (1kkl B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families)

5. Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
   automatically mapped to Pfam PF07475

6. Protein HPr kinase HprK C-terminal domain [64187] (3 species)

7. Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries)

8. Domain d1kklb_: 1kkl B: [72649]
   Other proteins in same PDB: d1kklh_, d1kkli_, d1kklj_
   C-terminal domain in complex with HPr
   complexed with ca

Details for d1kklb_

PDB Entry: 1kkl, 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis hpr

PDB Compounds: (B:) hprk protein

SCOPe Domain Sequences for d1kklb_:

Sequence, based on SEQRES records:

>d1kklb_ c.91.1.2 (B:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
ifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehne

Sequence, based on observed residues (ATOM records):

>d1kklb_ c.91.1.2 (B:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpgeqtqlifdvpvpki
tvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehne

Timeline for d1kklb_:

• d1kklb_ first appeared in SCOP 1.61
  
• d1kklb_ appears in SCOPe 2.04
  
• d1kklb_ appears in SCOPe 2.06
  
• d1kklb_ appears in the current release, SCOPe 2.08