Lineage for d1kklb_ (1kkl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143156Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
    automatically mapped to Pfam PF07475
  6. 2143157Protein HPr kinase HprK C-terminal domain [64187] (3 species)
  7. 2143158Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries)
  8. 2143163Domain d1kklb_: 1kkl B: [72649]
    Other proteins in same PDB: d1kklh_, d1kkli_, d1kklj_
    C-terminal domain in complex with HPr
    complexed with ca

Details for d1kklb_

PDB Entry: 1kkl (more details), 2.8 Å

PDB Description: L.casei HprK/P in complex with B.subtilis HPr
PDB Compounds: (B:) hprk protein

SCOPe Domain Sequences for d1kklb_:

Sequence, based on SEQRES records: (download)

>d1kklb_ c.91.1.2 (B:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtql
ifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehne

Sequence, based on observed residues (ATOM records): (download)

>d1kklb_ c.91.1.2 (B:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
errsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivga
appilshlleirglgiidvmnlfgagavredttislivhlenwtpgeqtqlifdvpvpki
tvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehne

SCOPe Domain Coordinates for d1kklb_:

Click to download the PDB-style file with coordinates for d1kklb_.
(The format of our PDB-style files is described here.)

Timeline for d1kklb_: