Lineage for d1kkja_ (1kkj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147847Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2148075Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 2148076Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries)
  8. 2148102Domain d1kkja_: 1kkj A: [72647]
    complexed with plp

Details for d1kkja_

PDB Entry: 1kkj (more details), 1.93 Å

PDB Description: Crystal Structure of Serine Hydroxymethyltransferase from B.stearothermophilus
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d1kkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkja_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

SCOPe Domain Coordinates for d1kkja_:

Click to download the PDB-style file with coordinates for d1kkja_.
(The format of our PDB-style files is described here.)

Timeline for d1kkja_: