SCOPe 2.07: Domain d1kkha2: 1kkh A:181-317

Lineage for d1kkha2 (1kkh A:181-317)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.3: Mevalonate kinase [75450] (1 protein)

6. Protein Mevalonate kinase [75451] (3 species)

7. Species Methanococcus jannaschii [TaxId:2190] [75452] (2 PDB entries)

8. Domain d1kkha2: 1kkh A:181-317 [72646]
   Other proteins in same PDB: d1kkha1, d1kkha3
   complexed with dio

Details for d1kkha2

PDB Entry: 1kkh, 2.4 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Mevalonate Kinase

PDB Compounds: (A:) Mevalonate Kinase

SCOPe Domain Sequences for d1kkha2:

Sequence; same for both SEQRES and ATOM records:

>d1kkha2 d.58.26.3 (A:181-317) Mevalonate kinase {Methanococcus jannaschii [TaxId: 2190]}
kgefeeflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknked
fgklmtknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekell
kelnkedvrifncrmmn

Timeline for d1kkha2:

• d1kkha2 first appeared in SCOP 1.61
  
• d1kkha2 appears in SCOPe 2.06
  
• d1kkha2 appears in the current release, SCOPe 2.08