Lineage for d1kkha2 (1kkh A:181-317)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910699Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1910721Family d.58.26.3: Mevalonate kinase [75450] (1 protein)
  6. 1910722Protein Mevalonate kinase [75451] (3 species)
  7. 1910728Species Methanococcus jannaschii [TaxId:2190] [75452] (2 PDB entries)
  8. 1910729Domain d1kkha2: 1kkh A:181-317 [72646]
    Other proteins in same PDB: d1kkha1
    complexed with dio

Details for d1kkha2

PDB Entry: 1kkh (more details), 2.4 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Mevalonate Kinase
PDB Compounds: (A:) Mevalonate Kinase

SCOPe Domain Sequences for d1kkha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkha2 d.58.26.3 (A:181-317) Mevalonate kinase {Methanococcus jannaschii [TaxId: 2190]}
kgefeeflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknked
fgklmtknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekell
kelnkedvrifncrmmn

SCOPe Domain Coordinates for d1kkha2:

Click to download the PDB-style file with coordinates for d1kkha2.
(The format of our PDB-style files is described here.)

Timeline for d1kkha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kkha1