Lineage for d1kkha2 (1kkh A:181-317)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.26: GHMP Kinase [55060] (4 families) 
Family d.58.26.3: Mevalonate kinase [75450] (1 protein) Protein Mevalonate kinase [75451] (2 species) Species Archaeon Methanococcus jannaschii [TaxId:2190] [75452] (1 PDB entry) 
Domain d1kkha2: 1kkh A:181-317 [72646]
Other proteins in same PDB: d1kkha1
Details for d1kkha2
PDB Entry: 1kkh (more details), 2.4 Å
PDB Description: Crystal Structure of the Methanococcus jannaschii Mevalonate Kinase
SCOP Domain Sequences for d1kkha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkha2 d.58.26.3 (A:181-317) Mevalonate kinase {Archaeon Methanococcus jannaschii}
kgefeeflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknked
fgklmtknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekell
kelnkedvrifncrmmn
SCOP Domain Coordinates for d1kkha2:
Click to download the PDB-style file with coordinates for d1kkha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kkha2:
- d1kkha2 is new in SCOP 1.61
- d1kkha2 appears in SCOP 1.63
- d1kkha2 appears in the current release, SCOPe 2.08
View in 3D
