Lineage for d1kkha1 (1kkh A:1-180)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1892132Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 1892178Protein Mevalonate kinase [75353] (3 species)
  7. 1892184Species Methanococcus jannaschii [TaxId:2190] [75354] (2 PDB entries)
  8. 1892185Domain d1kkha1: 1kkh A:1-180 [72645]
    Other proteins in same PDB: d1kkha2
    complexed with dio

Details for d1kkha1

PDB Entry: 1kkh (more details), 2.4 Å

PDB Description: Crystal Structure of the Methanococcus jannaschii Mevalonate Kinase
PDB Compounds: (A:) Mevalonate Kinase

SCOPe Domain Sequences for d1kkha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkha1 d.14.1.5 (A:1-180) Mevalonate kinase {Methanococcus jannaschii [TaxId: 2190]}
prgshmiietpskvilfgehavvygyraismaidltstieiketqedeiilnlndlnksl
glnlneikninpnnfgdfkyclcaikntldylniepktgfkinisskipiscglgssasi
tigtikavsgfynkelkddeiaklgymvekeiqgkasitdtstitykgileiknnkfrki

SCOPe Domain Coordinates for d1kkha1:

Click to download the PDB-style file with coordinates for d1kkha1.
(The format of our PDB-style files is described here.)

Timeline for d1kkha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kkha2