![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
![]() | Protein Initiation factor eIF2 gamma subunit [74964] (3 species) |
![]() | Species Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries) |
![]() | Domain d1kk3a2: 1kk3 A:322-410 [72641] Other proteins in same PDB: d1kk3a1, d1kk3a3 complexed with gdp, mg, zn |
PDB Entry: 1kk3 (more details), 1.9 Å
SCOPe Domain Sequences for d1kk3a2:
Sequence, based on SEQRES records: (download)
>d1kk3a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Pyrococcus abyssi [TaxId: 29292]} wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip vcaepgdrvaisrqigsrwrligygiike
>d1kk3a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Pyrococcus abyssi [TaxId: 29292]} wdslrlevhllervveqelkvepikrkevlllnvgtartmglvtglgkdeievklqipvc aepgdrvaisrqigsrwrligygiike
Timeline for d1kk3a2: