SCOPe 2.04: Domain d1kk2a3: 1kk2 A:6-200

Lineage for d1kk2a3 (1kk2 A:6-200)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
   includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)

7. Species Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)

8. Domain d1kk2a3: 1kk2 A:6-200 [72639]
   Other proteins in same PDB: d1kk2a1, d1kk2a2
   complexed with gdp, mg, zn; mutant

Details for d1kk2a3

PDB Entry: 1kk2, 2.1 Å

PDB Description: structure of the large gamma subunit of initiation factor eif2 from pyrococcus abyssi-g235d mutant complexed with gdp-mg2+

PDB Compounds: (A:) eIF2gamma

SCOPe Domain Sequences for d1kk2a3:

Sequence, based on SEQRES records:

>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records):

>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys
tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre
hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani
dvlvkaiedfipt

Timeline for d1kk2a3:

• d1kk2a3 first appeared in SCOP 1.61
  
• d1kk2a3 appears in SCOPe 2.03
  
• d1kk2a3 appears in SCOPe 2.05
  
• d1kk2a3 appears in the current release, SCOPe 2.08