Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species) includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211) |
Species Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries) |
Domain d1kk2a3: 1kk2 A:6-200 [72639] Other proteins in same PDB: d1kk2a1, d1kk2a2 complexed with gdp, mg, zn; mutant |
PDB Entry: 1kk2 (more details), 2.1 Å
SCOPe Domain Sequences for d1kk2a3:
Sequence, based on SEQRES records: (download)
>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]} srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga nidvlvkaiedfipt
>d1kk2a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]} srqaevnigmvghvdhgkttltkaltgvwtdseelrrgitikigfadaeirrcpncgrys tspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtre hlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgani dvlvkaiedfipt
Timeline for d1kk2a3: