Lineage for d1kk0a3 (1kk0 A:6-200)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475446Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
  7. 2475449Species Pyrococcus abyssi [TaxId:29292] [75205] (5 PDB entries)
  8. 2475453Domain d1kk0a3: 1kk0 A:6-200 [72633]
    Other proteins in same PDB: d1kk0a1, d1kk0a2
    complexed with zn

Details for d1kk0a3

PDB Entry: 1kk0 (more details), 1.95 Å

PDB Description: Structure of the large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi
PDB Compounds: (A:) eIF2gamma

SCOPe Domain Sequences for d1kk0a3:

Sequence, based on SEQRES records: (download)

>d1kk0a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdthseelrrgitikigfadaeirrcpncgr
ystspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqt
rehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhga
nidvlvkaiedfipt

Sequence, based on observed residues (ATOM records): (download)

>d1kk0a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Pyrococcus abyssi [TaxId: 29292]}
srqaevnigmvghvdhgkttltkaltgvwtdhseelrrgitikigfadaeirrcpncgry
stspvcpycghetefvrrvsfidapghealmttmlagaslmdgailviaanepcprpqtr
ehlmalqiigqkniiiaqnkielvdkekalenyrqikefiegtvaenapiipisalhgan
idvlvkaiedfipt

SCOPe Domain Coordinates for d1kk0a3:

Click to download the PDB-style file with coordinates for d1kk0a3.
(The format of our PDB-style files is described here.)

Timeline for d1kk0a3: