SCOPe 2.07: Domain d1kk0a2: 1kk0 A:322-410

Lineage for d1kk0a2 (1kk0 A:322-410)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (3 species)

7. Species Pyrococcus abyssi [TaxId:29292] [74965] (5 PDB entries)

8. Domain d1kk0a2: 1kk0 A:322-410 [72632]
   Other proteins in same PDB: d1kk0a1, d1kk0a3
   complexed with zn

Details for d1kk0a2

PDB Entry: 1kk0, 1.95 Å

PDB Description: Structure of the large gamma subunit of initiation factor eIF2 from Pyrococcus abyssi

PDB Compounds: (A:) eIF2gamma

SCOPe Domain Sequences for d1kk0a2:

Sequence; same for both SEQRES and ATOM records:

>d1kk0a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Pyrococcus abyssi [TaxId: 29292]}
wdslrlevhllervvgteqelkvepikrkevlllnvgtartmglvtglgkdeievklqip
vcaepgdrvaisrqigsrwrligygiike

Timeline for d1kk0a2:

• d1kk0a2 first appeared in SCOP 1.61
  
• d1kk0a2 appears in SCOPe 2.06
  
• d1kk0a2 appears in the current release, SCOPe 2.08