Lineage for d1kjyc1 (1kjy C:1061-1181)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154155Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
  4. 154156Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
  5. 154157Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 154158Protein Transducin (alpha subunit), insertion domain [47897] (2 species)
  7. 154176Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries)
  8. 154193Domain d1kjyc1: 1kjy C:1061-1181 [72626]
    Other proteins in same PDB: d1kjya2, d1kjyc2

Details for d1kjyc1

PDB Entry: 1kjy (more details), 2.7 Å

PDB Description: Crystal Structure of Human G[alpha]i1 Bound to the GoLoco Motif of RGS14

SCOP Domain Sequences for d1kjyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjyc1 a.66.1.1 (C:1061-1181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOP Domain Coordinates for d1kjyc1:

Click to download the PDB-style file with coordinates for d1kjyc1.
(The format of our PDB-style files is described here.)

Timeline for d1kjyc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjyc2