SCOP 1.61: Domain d1kjyc1: 1kjy C:1061-1181

Lineage for d1kjyc1 (1kjy C:1061-1181)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries)

8. Domain d1kjyc1: 1kjy C:1061-1181 [72626]
   Other proteins in same PDB: d1kjya2, d1kjyc2

Details for d1kjyc1

PDB Entry: 1kjy, 2.7 Å

PDB Description: Crystal Structure of Human G[alpha]i1 Bound to the GoLoco Motif of RGS14

SCOP Domain Sequences for d1kjyc1:

Sequence; same for both SEQRES and ATOM records:

>d1kjyc1 a.66.1.1 (C:1061-1181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1kjyc1:

• d1kjyc1 is new in SCOP 1.61
  
• d1kjyc1 appears in SCOP 1.63
  
• d1kjyc1 appears in the current release, SCOPe 2.08