SCOP 1.65: Domain d1kjya2: 1kjy A:30-60,A:182-349

Lineage for d1kjya2 (1kjy A:30-60,A:182-349)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (2 species)
   common fold is interrupted with an all-alpha domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries)

8. Domain d1kjya2: 1kjy A:30-60,A:182-349 [72625]
   Other proteins in same PDB: d1kjya1, d1kjyc1

Details for d1kjya2

PDB Entry: 1kjy, 2.7 Å

PDB Description: Crystal Structure of Human G[alpha]i1 Bound to the GoLoco Motif of RGS14

SCOP Domain Sequences for d1kjya2:

Sequence; same for both SEQRES and ATOM records:

>d1kjya2 c.37.1.8 (A:30-60,A:182-349) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
garevkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserk
kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
knvqfvfdavtdviiknnlk

Timeline for d1kjya2:

• d1kjya2 first appeared in SCOP 1.61
  
• d1kjya2 appears in SCOP 1.63
  
• d1kjya2 appears in SCOP 1.67
  
• d1kjya2 appears in the current release, SCOPe 2.08