SCOP 1.61: Domain d1kjqb1: 1kjq B:319-392

Lineage for d1kjqb1 (1kjq B:319-392)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)

6. Protein Glycinamide ribonucleotide transformylase PurT [51254] (1 species)

7. Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)

8. Domain d1kjqb1: 1kjq B:319-392 [72619]
   Other proteins in same PDB: d1kjqa2, d1kjqa3, d1kjqb2, d1kjqb3

Details for d1kjqb1

PDB Entry: 1kjq, 1.05 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP

SCOP Domain Sequences for d1kjqb1:

Sequence; same for both SEQRES and ATOM records:

>d1kjqb1 b.84.2.1 (B:319-392) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

Timeline for d1kjqb1:

• d1kjqb1 is new in SCOP 1.61
  
• d1kjqb1 appears in SCOP 1.63
  
• d1kjqb1 appears in the current release, SCOPe 2.08