Lineage for d1kjqb1 (1kjq B:319-392)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072005Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2072108Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2072109Family b.84.2.1: BC C-terminal domain-like [51247] (5 protein domains)
    probable rudiment form of the biotinyl-carrier domain
  6. 2072177Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)
  7. 2072178Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)
  8. 2072180Domain d1kjqb1: 1kjq B:319-392 [72619]
    Other proteins in same PDB: d1kjqa2, d1kjqa3, d1kjqb2, d1kjqb3
    complexed with adp, cl, edo, mg, mpo, na

Details for d1kjqb1

PDB Entry: 1kjq (more details), 1.05 Å

PDB Description: Crystal structure of glycinamide ribonucleotide transformylase in complex with Mg-ADP
PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kjqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjqb1 b.84.2.1 (B:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOPe Domain Coordinates for d1kjqb1:

Click to download the PDB-style file with coordinates for d1kjqb1.
(The format of our PDB-style files is described here.)

Timeline for d1kjqb1: